HPA068384

antibody from Atlas Antibodies

Targeting: CD5L API6, Spalpha

Antibody data

Submit

Validation data

Product number: HPA068384 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA068384, RRID:AB_2685979
Product name: Anti-CD5L
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: LGCGAASGTPSGILYEPPAEKEQKVLIQSVSCTGT EDTLAQCEQEEVYDC
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

CD5L protein structure - HPA068384 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human spleen and cerebral cortex tissues using HPA068384 antibody. Corresponding CD5L RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex, fallopian tube, liver and spleen using Anti-CD5L antibody HPA068384 (A) shows similar protein distribution across tissues to independent antibody HPA065686 (B).
Antibody #2 product nr: HPA065686
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human spleen shows strong cytoplasmic positivity in red pulp.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human spleen shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human spleen shows moderate cytoplasmic positivity in cells in red pulp.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex shows no cytoplasmic positivity in neurons as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver shows moderate cytoplasmic positivity in Kupffer cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human fallopian tube shows moderate positivity in plasma in blood vessels.
Sample type: HUMAN