HPA018805

antibody from Atlas Antibodies

Targeting: RASAL2 nGAP

Antibody data

Submit

Validation data

Product number: HPA018805 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA018805, RRID:AB_1856085
Product name: Anti-RASAL2
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: PRQNSTGQAQIRKVDQGGLGARAKAPPSLPHSASL RSTGSMSVVSAALVAEPVQNGSRSRQQSSSSRESP VPKVRAIQRQQTQQVQSPVDSATMSPVERTAAWVL NNGQY
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

RASAL2 protein structure - HPA018805 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human cerebral cortex and skeletal muscle tissues using HPA018805 antibody. Corresponding RASAL2 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human stomach shows strong positivity in mucus producing glandular cells.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex shows moderate to strong cytoplasmic positivity in neuronal cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human placenta shows moderate cytoplasmic positivity in trophoblastic cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human stomach shows moderate cytoplasmic positivity in glandular cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human skeletal muscle shows no positivity in myocytes as expected.
Sample type: HUMAN