Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA009027 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA009027, RRID:AB_1080458
- Product name
- Anti-ULK2
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
VVRRSNTSPMGFLRPGSCSPVPADTAQTVGRRLST
GSSRPYSPSPLVGTIPEQFSQCCCGHPQGHDSRSR
NSSGSPVPQAQSPQSLLSGARLQSAPTLTDIYQNK
QKLRKQHSDPVCPSHTGAGYSYSPQPSRPGSLGTS
PTKH- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references ULK2 is essential for degradation of ubiquitinated protein aggregates and homeostasis in skeletal muscle
Transcriptional control of autophagy–lysosome function drives pancreatic cancer metabolism
Methylation Silencing of ULK2, an Autophagy Gene, Is Essential for Astrocyte Transformation and Tumor Growth
Fuqua J, Mere C, Kronemberger A, Blomme J, Bae D, Turner K, Harris M, Scudese E, Edwards M, Ebert S, de Sousa L, Bodine S, Yang L, Adams C, Lira V
The FASEB Journal 2019;33(11):11735-12745
The FASEB Journal 2019;33(11):11735-12745
Transcriptional control of autophagy–lysosome function drives pancreatic cancer metabolism
Perera R, Stoykova S, Nicolay B, Ross K, Fitamant J, Boukhali M, Lengrand J, Deshpande V, Selig M, Ferrone C, Settleman J, Stephanopoulos G, Dyson N, Zoncu R, Ramaswamy S, Haas W, Bardeesy N
Nature 2015;524(7565):361-365
Nature 2015;524(7565):361-365
Methylation Silencing of ULK2, an Autophagy Gene, Is Essential for Astrocyte Transformation and Tumor Growth
Shukla S, Patric I, Patil V, Shwetha S, Hegde A, Chandramouli B, Arivazhagan A, Santosh V, Somasundaram K
Journal of Biological Chemistry 2014;289(32):22306-22318
Journal of Biological Chemistry 2014;289(32):22306-22318
No comments: Submit comment
No validations: Submit validation data