Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA009027 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA009027, RRID:AB_1080458
- Product name
- Anti-ULK2
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
VVRRSNTSPMGFLRPGSCSPVPADTAQTVGRRLST
GSSRPYSPSPLVGTIPEQFSQCCCGHPQGHDSRSR
NSSGSPVPQAQSPQSLLSGARLQSAPTLTDIYQNK
QKLRKQHSDPVCPSHTGAGYSYSPQPSRPGSLGTS
PTKH- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Transcriptional control of autophagy-lysosome function drives pancreatic cancer metabolism.
Methylation silencing of ULK2, an autophagy gene, is essential for astrocyte transformation and tumor growth.
Perera RM, Stoykova S, Nicolay BN, Ross KN, Fitamant J, Boukhali M, Lengrand J, Deshpande V, Selig MK, Ferrone CR, Settleman J, Stephanopoulos G, Dyson NJ, Zoncu R, Ramaswamy S, Haas W, Bardeesy N
Nature 2015 Aug 20;524(7565):361-5
Nature 2015 Aug 20;524(7565):361-5
Methylation silencing of ULK2, an autophagy gene, is essential for astrocyte transformation and tumor growth.
Shukla S, Patric IR, Patil V, Shwetha SD, Hegde AS, Chandramouli BA, Arivazhagan A, Santosh V, Somasundaram K
The Journal of biological chemistry 2014 Aug 8;289(32):22306-18
The Journal of biological chemistry 2014 Aug 8;289(32):22306-18
No comments: Submit comment
Enhanced validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Recombinant expression validation
- Main image
- Experimental details
- Western blot analysis in control (vector only transfected HEK293T lysate) and ULK2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY402363).
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human urinary bladder shows cytoplasmic and membranous positivity in urothelial cells.
- Sample type
- HUMAN