Antibody data
- Antibody Data
- Antigen structure
- References [7]
- Comments [0]
- Validations
- Immunohistochemistry [6]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA027179 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA027179, RRID:AB_1851987
- Product name
- Anti-KDM5B
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
DGINSLERKLKRRLEREGLSSERWERVKKMRTPKK
KKIKLSHPKDMNNFKLERERSYELVRSAETHSLPS
DTSYSEQEDSE- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Overexpression of JARID1B is associated with poor prognosis and chemotherapy resistance in epithelial ovarian cancer.
Physical and functional interactions between the histone H3K4 demethylase KDM5A and the nucleosome remodeling and deacetylase (NuRD) complex.
Histone demethylase jumonji AT-rich interactive domain 1B (JARID1B) controls mammary gland development by regulating key developmental and lineage specification genes.
JARID1B is a luminal lineage-driving oncogene in breast cancer.
The Histone-H3K4-Specific Demethylase KDM5B Binds to Its Substrate and Product through Distinct PHD Fingers
The human melanoma side population displays molecular and functional characteristics of enriched chemoresistance and tumorigenesis.
Overexpression of the JmjC histone demethylase KDM5B in human carcinogenesis: involvement in the proliferation of cancer cells through the E2F/RB pathway.
Wang L, Mao Y, Du G, He C, Han S
Tumour biology : the journal of the International Society for Oncodevelopmental Biology and Medicine 2015 Apr;36(4):2465-72
Tumour biology : the journal of the International Society for Oncodevelopmental Biology and Medicine 2015 Apr;36(4):2465-72
Physical and functional interactions between the histone H3K4 demethylase KDM5A and the nucleosome remodeling and deacetylase (NuRD) complex.
Nishibuchi G, Shibata Y, Hayakawa T, Hayakawa N, Ohtani Y, Sinmyozu K, Tagami H, Nakayama J
The Journal of biological chemistry 2014 Oct 17;289(42):28956-70
The Journal of biological chemistry 2014 Oct 17;289(42):28956-70
Histone demethylase jumonji AT-rich interactive domain 1B (JARID1B) controls mammary gland development by regulating key developmental and lineage specification genes.
Zou MR, Cao J, Liu Z, Huh SJ, Polyak K, Yan Q
The Journal of biological chemistry 2014 Jun 20;289(25):17620-33
The Journal of biological chemistry 2014 Jun 20;289(25):17620-33
JARID1B is a luminal lineage-driving oncogene in breast cancer.
Yamamoto S, Wu Z, Russnes HG, Takagi S, Peluffo G, Vaske C, Zhao X, Moen Vollan HK, Maruyama R, Ekram MB, Sun H, Kim JH, Carver K, Zucca M, Feng J, Almendro V, Bessarabova M, Rueda OM, Nikolsky Y, Caldas C, Liu XS, Polyak K
Cancer cell 2014 Jun 16;25(6):762-77
Cancer cell 2014 Jun 16;25(6):762-77
The Histone-H3K4-Specific Demethylase KDM5B Binds to Its Substrate and Product through Distinct PHD Fingers
Klein B, Piao L, Xi Y, Rincon-Arano H, Rothbart S, Peng D, Wen H, Larson C, Zhang X, Zheng X, Cortazar M, Peña P, Mangan A, Bentley D, Strahl B, Groudine M, Li W, Shi X, Kutateladze T
Cell Reports 2014 January;6(2):325-335
Cell Reports 2014 January;6(2):325-335
The human melanoma side population displays molecular and functional characteristics of enriched chemoresistance and tumorigenesis.
Wouters J, Stas M, Gremeaux L, Govaere O, Van den Broeck A, Maes H, Agostinis P, Roskams T, van den Oord JJ, Vankelecom H
PloS one 2013;8(10):e76550
PloS one 2013;8(10):e76550
Overexpression of the JmjC histone demethylase KDM5B in human carcinogenesis: involvement in the proliferation of cancer cells through the E2F/RB pathway.
Hayami S, Yoshimatsu M, Veerakumarasivam A, Unoki M, Iwai Y, Tsunoda T, Field HI, Kelly JD, Neal DE, Yamaue H, Ponder BA, Nakamura Y, Hamamoto R
Molecular cancer 2010 Mar 13;9:59
Molecular cancer 2010 Mar 13;9:59
No comments: Submit comment
Enhanced validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Immunohistochemistry analysis in human testis and skeletal muscle tissues using HPA027179 antibody. Corresponding KDM5B RNA-seq data are presented for the same tissues.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human testis shows moderate to strong nuclear positivity in cells in seminiferous ducts and Leydig cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human skin shows moderate to strong nuclear positivity in epidermal cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human tonsil shows moderate to strong nuclear positivity in lymphoid cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human rectum shows moderate to strong nuclear positivity in glandular cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human skeletal muscle shows weak nuclear positivity in myocytes.
- Sample type
- HUMAN