Antibody data
- Antibody Data
- Antigen structure
- References [4]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00010753-M02 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00010753-M02, RRID:AB_529977
- Product name
- CAPN9 monoclonal antibody (M02), clone 3A6
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant CAPN9.
- Antigen sequence
DKLKQWINLFLRFDADKSGTMSTYELRTALKAAGF
QLSSHLLQLIVLRYADEELQLDFDDFLNCLVRLEN
ASRVFQALSTKNKEFIHLNINEFIHLTMNI- Isotype
- IgG
- Antibody clone number
- 3A6
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Low calpain-9 is associated with adverse disease-specific survival following endocrine therapy in breast cancer.
Expression of the calpain system is associated with poor clinical outcome in gastro-oesophageal adenocarcinomas.
Calpain 8/nCL-2 and calpain 9/nCL-4 constitute an active protease complex, G-calpain, involved in gastric mucosal defense.
Role of calpain-9 and PKC-delta in the apoptotic mechanism of lumen formation in CEACAM1 transfected breast epithelial cells.
Davis J, Martin SG, Patel PM, Green AR, Rakha EA, Ellis IO, Storr SJ
BMC cancer 2014 Dec 23;14:995
BMC cancer 2014 Dec 23;14:995
Expression of the calpain system is associated with poor clinical outcome in gastro-oesophageal adenocarcinomas.
Storr SJ, Pu X, Davis J, Lobo D, Reece-Smith AM, Parsons SL, Madhusudan S, Martin SG
Journal of gastroenterology 2013 Nov;48(11):1213-21
Journal of gastroenterology 2013 Nov;48(11):1213-21
Calpain 8/nCL-2 and calpain 9/nCL-4 constitute an active protease complex, G-calpain, involved in gastric mucosal defense.
Hata S, Abe M, Suzuki H, Kitamura F, Toyama-Sorimachi N, Abe K, Sakimura K, Sorimachi H
PLoS genetics 2010 Jul 29;6(7):e1001040
PLoS genetics 2010 Jul 29;6(7):e1001040
Role of calpain-9 and PKC-delta in the apoptotic mechanism of lumen formation in CEACAM1 transfected breast epithelial cells.
Chen CJ, Nguyen T, Shively JE
Experimental cell research 2010 Feb 15;316(4):638-48
Experimental cell research 2010 Feb 15;316(4):638-48
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- CAPN9 monoclonal antibody (M02), clone 3A6. Western Blot analysis of CAPN9 expression in human colon.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged CAPN9 is approximately 0.1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoperoxidase of monoclonal antibody to CAPN9 on formalin-fixed paraffin-embedded human liver. [antibody concentration 1 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol