Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00084838-M08 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00084838-M08, RRID:AB_607316
- Product name
- ZNF496 monoclonal antibody (M08), clone 2B3
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant ZNF496.
- Antigen sequence
HLQPDRLQPVEKREQAASEDADKGPKEPLENGKAK
LSFQCCECGKAFQRHDHLARHRSHFHLKDKARPFQ
CRYCVKSFTQNYDLLRHERLHMKRRSKQALN- Isotype
- IgG
- Antibody clone number
- 2B3
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- ZNF496 monoclonal antibody (M08), clone 2B3 Western Blot analysis of ZNF496 expression in NIH/3T3 ( Cat # L018V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of monoclonal antibody to ZNF496 on NIH/3T3 cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoperoxidase of monoclonal antibody to ZNF496 on formalin-fixed paraffin-embedded human cholangiocarcinoma. [antibody concentration 1.5 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol