H00083478-B01

ARHGAP24 antibody from Abnova Corporation
DKFZP564B1162, FilGAP, FLJ33877

Antibody data

Product number
H00083478-B01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00083478-B01, RRID:AB_10550500
Product name
ARHGAP24 MaxPab mouse polyclonal antibody (B01)
Provider product page
Abnova Corporation - H00083478-B01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human ARHGAP24 protein.
Antigen sequence
MTANHESYLLMASTQNDMEDWVKSIRRVIWGPFGG
GIFGQKLEDTVRYEKRYGNRLAPMLVEQCVDFIRQ
RGLKEEGLFRLPGQANLVKELQDAFDCGEKPSFDS
NTDVHTVASLLKLYLRELPEPVIPYAKYEDFLSCA
KLLSKEEEAGVKELAKQVKSLPVVNYNLLKYICRF
LDEVQSYSGVNKMSVQNLATVFGPNILRPKVEDPL
TIMEGTVVVQQLMSVMISKHDCLFPKDAELQSKPQ
DGVSNNNEIQKKATMGQLQNKENNNTKDSPSRQCS
WDKSESPQRSSMNNGSPTALSGSKTNSPKNSVHKL
DVSRSPPLMVKKNPAFNKGSGIVTNGSFSSSNAEG
LEKTQTTPNGSLQARRSSSLKVSGTKMGTHSVQNG
TVRMGILNSDTLGNPTNVRNMSWLPNGYVTLRDNK
QKEQAGELGQHNRLSTYDNVHQQFSMMNLDDKQSI
DSATWSTSSCEISLPENSNSCRSSTTTCPEQDFFG
GNFEDPVLDGPPQDDLSHPRDYESKSDHRSVGGRS
SRATSSSDNSETFVGNSSSNHSALHSLVSSLKQEM
TKQKIEYESRIKSLEQRNLTLETEMMSLHDELDQE
RKKFTMIEIKMRNAERAKEDAEKRNDMLQKEMEQF
FSTFGELTVEPRRTERGNTIWIQ
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -