Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [2]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00007162-M09 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00007162-M09, RRID:AB_939503
- Product name
- TPBG monoclonal antibody (M09), clone 1B6
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant TPBG.
- Antigen sequence
SNHFLYLPRDVLAQLPSLRHLDLSNNSLVSLTYVS
FRNLTHLESLHLEDNALKVLHNGTLAELQGLPHIR
VFLDNNPWVCDCHMADMVTWLKETEVVQGKDRLTC
AYPEK- Isotype
- IgG
- Antibody clone number
- 1B6
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- TPBG monoclonal antibody (M09), clone 1B6. Western Blot analysis of TPBG expression in PC-12(Cat # L012V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged TPBG is approximately 1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged TPBG is 0.3 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol