Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN405774 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-SAM Domain, SH3 Domain and Nuclear Localization Signals, 1 (SAMSN1) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-SAMSN1 antibody: synthetic peptide directed towards the middle region of human SAMSN1
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian
- Host
- Rabbit
- Antigen sequence
YVDVISEEEAAPKKIKANRRSNSKKSKTLQEFLER
IHLQE YTSTLLLNGY- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references The SH3-SAM adaptor HACS1 is up-regulated in B cell activation signaling cascades.
Zhu YX, Benn S, Li ZH, Wei E, Masih-Khan E, Trieu Y, Bali M, McGlade CJ, Claudio JO, Stewart AK
The Journal of experimental medicine 2004 Sep 20;200(6):737-47
The Journal of experimental medicine 2004 Sep 20;200(6):737-47
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting