Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN184157 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Tumor Necrosis Factor Receptor Superfamily, Member 18 (TNFRSF18) (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-TNFRSF18 antibody: synthetic peptide directed towards the C terminal of human TNFRSF18
- Description
- Protein A purified
- Reactivity
- Human
- Host
- Rabbit
- Antigen sequence
LHIWQLRKTQLLLEVPPSTEDARSCQFPEEERGER
SAEEK GRLGDLWV- Epitope
- C-Term
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Glucocorticoid-induced tumor necrosis factor receptor negatively regulates activation of human primary natural killer (NK) cells by blocking proliferative signals and increasing NK cell apoptosis.
Liu B, Li Z, Mahesh SP, Pantanelli S, Hwang FS, Siu WO, Nussenblatt RB
The Journal of biological chemistry 2008 Mar 28;283(13):8202-10
The Journal of biological chemistry 2008 Mar 28;283(13):8202-10
No comments: Submit comment
No validations: Submit validation data