HPA012602

antibody from Atlas Antibodies

Targeting: CHGB SCG1, SgI

Antibody data

Submit

Validation data

Product number: HPA012602 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA012602, RRID:AB_1846706
Product name: Anti-CHGB
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: SEVDKRRTRPRHHHGRSRPDRSSQGGSLPSEEKGH PQEESEESNVSMASLGEKRDHHSTHYRASEEEPEY GEEIKGYPGVQAPEDLEWERYRGRGSEEYRAPRPQ SEESWDEEDKRNYPSLELDKMAHGYGEESE
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

CHGB protein structure - HPA012602 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human adrenal gland and colon tissues using Anti-CHGB antibody. Corresponding CHGB RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human adrenal gland, colon, kidney and liver using Anti-CHGB antibody HPA012602 (A) shows similar protein distribution across tissues to independent antibody HPA008759 (B).
Antibody #2 product nr: HPA008759
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human pancreas shows strong cytoplasmic positivity in islet cells.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human adrenal gland shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human anterior pituitary gland shows strong cytoplasmic positivity in endocrine cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human colon shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney using Anti-CHGB antibody HPA012602.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver using Anti-CHGB antibody HPA012602.
Sample type: HUMAN