HPA015103

antibody from Atlas Antibodies

Targeting: PTPRZ1 phosphacan, PTP18, PTPRZ, PTPZ, RPTPB

Antibody data

Submit

Validation data

Product number: HPA015103 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA015103, RRID:AB_1855946
Product name: Anti-PTPRZ1
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: LFRHLHTVSQILPQVTSATESDKVPLHASLPVAGG DLLLEPSLAQYSDVLSTTHAASETLEFGSESGVLY KTLMFSQVEPPSSDAMMHARSSGPEPSYALSDNEG SQHIFTVSYSSAIPVHDSVGVTYQGSLFSGPSHIP IPKSSLIT
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

PTPRZ1 protein structure - HPA015103 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human cerebral cortex and liver tissues using HPA015103 antibody. Corresponding PTPRZ1 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex shows strong cytoplasmic positivity in a subset of neuronal cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human glioma shows moderate cytoplasmic positivity in tumor cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver shows no positivity as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebellum shows weak to moderate cytoplasmic positivity in Purkinje cells.
Sample type: HUMAN