Explore
Validate
Learn
Western blot
ImmunohistochemistryAntibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA041089 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA041089, RRID:AB_10805836
- Product name
- Anti-PPP4R1
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
LDAHEETISIEKRSDLQDELDINELPNCKINQEDS
VPLISDAVENMDSTLHYIHSDSDLSNNSSFSPDEE
RRTKVQ- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references PP4R1 accelerates cell growth and proliferation in HepG2 hepatocellular carcinoma.
Lentivirus-Mediated Short-Hairpin RNA Targeting Protein Phosphatase 4 Regulatory Subunit 1 Inhibits Growth in Breast Cancer.
Wu G, Ma Z, Qian J, Liu B
OncoTargets and therapy 2015;8:2067-74
OncoTargets and therapy 2015;8:2067-74
Lentivirus-Mediated Short-Hairpin RNA Targeting Protein Phosphatase 4 Regulatory Subunit 1 Inhibits Growth in Breast Cancer.
Qi Y, Hu T, Li K, Ye R, Ye Z
Journal of breast cancer 2015 Sep;18(3):218-24
Journal of breast cancer 2015 Sep;18(3):218-24
No comments: Submit comment
Enhanced validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Independent antibody validation
- Main image
- Experimental details
- Western blot analysis using Anti-PPP4R1 antibody HPA041089 (A) shows similar pattern to independent antibody HPA040905 (B).
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human colon shows strong cytoplasmic positivity in glandular cells.
- Sample type
- HUMAN
