Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00056907-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00056907-M01, RRID:AB_519065
- Product name
- SPIRE1 monoclonal antibody (M01), clone 4C5
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant SPIRE1.
- Antigen sequence
SEKPSTAHHRPLRSIARFSSKSKSMDKSDEELQFP
KELMEDWSTMEVCVDCKKFISEIISSSRRSLVLAN
KRARLKRKTQSFYMSSPGPSEYCPSERTISEI- Isotype
- IgG
- Antibody clone number
- 4C5
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Annexin A2-dependent polymerization of actin mediates endosome biogenesis.
Actin S-nitrosylation inhibits neutrophil beta2 integrin function.
Morel E, Parton RG, Gruenberg J
Developmental cell 2009 Mar;16(3):445-57
Developmental cell 2009 Mar;16(3):445-57
Actin S-nitrosylation inhibits neutrophil beta2 integrin function.
Thom SR, Bhopale VM, Mancini DJ, Milovanova TN
The Journal of biological chemistry 2008 Apr 18;283(16):10822-34
The Journal of biological chemistry 2008 Apr 18;283(16):10822-34
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of SPIRE1 expression in transfected 293T cell line by SPIRE1 monoclonal antibody (M01), clone 4C5.Lane 1: SPIRE1 transfected lysate(15 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged SPIRE1 is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol