Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- AMAb90698 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#AMAb90698, RRID:AB_2665635
- Product name
- Anti-CNDP1
- Antibody type
- Monoclonal
- Reactivity
- Human
- Host
- Mouse
- Conjugate
- Unconjugated
- Antigen sequence
PALLEKVFQYIDLHQDEFVQTLKEWVAIESDSVQP
VPRFRQELFRMMAVAADTLQRLGARVASVDMGPQQ
LPDGQSLPIPPVILAELGSDPTKGTVCFYGHL- Epitope
- Binds to an epitope located within the peptide sequence DEFVQTLKEWVAIES as determined by overlapping synthetic peptides.
- Isotype
- IgG
- Antibody clone number
- CL0339
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Analysis of plasma from prostate cancer patients links decreased carnosine dipeptidase 1 levels to lymph node metastasis
Qundos U, Johannesson H, Fredolini C, O’Hurley G, Branca R, Uhlén M, Wiklund F, Bjartell A, Nilsson P, Schwenk J
Translational Proteomics 2014 March;2
Translational Proteomics 2014 March;2
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Lane 1: Marker [kDa]Lane 2: Human plasma