HPA013136

antibody from Atlas Antibodies

Targeting: SCG5 7B2, SGNE1, SgV

Antibody data

Submit

Validation data

Product number: HPA013136 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA013136, RRID:AB_1856657
Product name: Anti-SCG5
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: EGLQHLGPFGNIPNIVAELTGDNIPKDFSEDQGYP DPPNPCPVGKTADDGCLENTPDTAEFSREFQLHQH LFDPEHDYPGLGKWNKKLLYEKMKGGERRKRRSVN PYLQGQRLDNVVAKKSV
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

SCG5 protein structure - HPA013136 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human lymph node, pancreas, pituitary gland and testis using Anti-SCG5 antibody HPA013136 (A) shows similar protein distribution across tissues to independent antibody HPA074618 (B).
Antibody #2 product nr: HPA074618
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human pancreas shows strong cytoplasmic positivity in islet cells.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human lymph node using Anti-SCG5 antibody HPA013136.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human pancreas using Anti-SCG5 antibody HPA013136.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis using Anti-SCG5 antibody HPA013136.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human pituitary gland using Anti-SCG5 antibody HPA013136.
Sample type: HUMAN