Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA010023 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA010023, RRID:AB_1851206
- Product name
- Anti-HSPA4
- Antibody type
- Polyclonal
- Reactivity
- Human, Mouse, Rat
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
FEELGKQIQQYMKIISSFKNKEDQYDHLDAADMTK
VEKSTNEAMEWMNNKLNLQNKQSLTMDPVVKSKEI
EAKIKELTSTCSPIISKPKPKVEPPKEEQKNAEQN
GPVDG- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Comparative proteomics analysis of gastric cancer stem cells.
Morisaki T, Yashiro M, Kakehashi A, Inagaki A, Kinoshita H, Fukuoka T, Kasashima H, Masuda G, Sakurai K, Kubo N, Muguruma K, Ohira M, Wanibuchi H, Hirakawa K
PloS one 2014;9(11):e110736
PloS one 2014;9(11):e110736
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & cytosol.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human testis shows nuclear and cytoplasmic positivity in cells in seminiferous ducts and Leydig cells.
- Sample type
- HUMAN