HPA011893

antibody from Atlas Antibodies

Targeting: SCG2 CHGC, SgII, SN

Antibody data

Submit

Validation data

Product number: HPA011893 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA011893, RRID:AB_1856656
Product name: Anti-SCG2
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: NLLGMESAANQKTSYFPNPYNQEKVLPRLPYGAGR SRSNQLPKAAWIPHVENRQMAYENLNDKDQELGEY LARMLVKYPEIINSNQVKRVPGQGSSEDDLQEEEQ IEQAIKEHLNQGSSQETDKLAPVSKRFPVGPPKND DTP
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

SCG2 protein structure - HPA011893 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human adrenal gland and liver tissues using Anti-SCG2 antibody. Corresponding SCG2 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human adrenal gland, cerebral cortex, lymph node and pituitary gland using Anti-SCG2 antibody HPA011893 (A) shows similar protein distribution across tissues to independent antibody HPA075062 (B).
Antibody #2 product nr: HPA075062
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human prostate shows strong cytoplasmic and membranous positivity in glandular cells.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human adrenal gland shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human adrenal gland shows strong cytoplasmic positivity in medullary cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human pituitary gland using Anti-SCG2 antibody HPA011893.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human lymph node using Anti-SCG2 antibody HPA011893.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex using Anti-SCG2 antibody HPA011893.
Sample type: HUMAN