HPA039796

antibody from Atlas Antibodies

Targeting: CACNA1C CACH2, CACN2, CACNL1A1, Cav1.2, CCHL1A1, LQT8, TS

Antibody data

Submit

Validation data

Product number: HPA039796 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA039796, RRID:AB_10673019
Product name: Anti-CACNA1C
Antibody type: Polyclonal
Description: Affinity purified using the PrEST antigen as affinity ligand
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: QDETYEVKMNHDTEACSEPSLLSTEMLSYQDDENR QLTLPEEDKRDIRQSPKRGFLRSASLGRRASFHLE CLKRQKDRGGDISQKTVLPLHLVHHQALAVAGLS
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

CACNA1C protein structure - HPA039796 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human prostate and skeletal muscle tissues using HPA039796 antibody. Corresponding CACNA1C RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human heart muscle shows distinct membranous positivity in myocytes.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human heart shows strong positivity in plasma membrane of cardiomyocytes.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human prostate shows moderate positivity in plasma membrane in smooth muscle cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex shows strong positivity in plasma membrane in endothelial cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human skeletal muscle shows no positivity in striated muscle fibers as expected, while endothelium is strongly stained.
Sample type: HUMAN