Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN309683 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Ring Finger Protein 138 (RNF138) (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-RNF138 antibody: synthetic peptide directed towards the C terminal of human RNF138
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine
- Host
- Rabbit
- Antigen sequence
LFQIVPVTCPICVSLPWGDPSQITRNFVSHLNQRH
QFDYG EFVNLQLDEE- Epitope
- C-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references NARF, an nemo-like kinase (NLK)-associated ring finger protein regulates the ubiquitylation and degradation of T cell factor/lymphoid enhancer factor (TCF/LEF).
Yamada M, Ohnishi J, Ohkawara B, Iemura S, Satoh K, Hyodo-Miura J, Kawachi K, Natsume T, Shibuya H
The Journal of biological chemistry 2006 Jul 28;281(30):20749-60
The Journal of biological chemistry 2006 Jul 28;281(30):20749-60
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting