Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Immunohistochemistry [5]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA004162 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA004162, RRID:AB_2667155
- Product name
- Anti-SALL2
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
FLAHQNACSTDPPVMVIIGGQENPNNSSASSEPRP
EGHNNPQVMDTEHSNPPDSGSSVPTDPTWGPERRG
EESSGHFLVAATGTAAGGGGGLILASPKLGATPLP
PESTPA- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Single-cell RNA-Seq resolves cellular complexity in sensory organs from the neonatal inner ear.
Sall2 is required for proapoptotic Noxa expression and genotoxic stress-induced apoptosis by doxorubicin.
Burns JC, Kelly MC, Hoa M, Morell RJ, Kelley MW
Nature communications 2015 Oct 15;6:8557
Nature communications 2015 Oct 15;6:8557
Sall2 is required for proapoptotic Noxa expression and genotoxic stress-induced apoptosis by doxorubicin.
Escobar D, Hepp MI, Farkas C, Campos T, Sodir NM, Morales M, Álvarez CI, Swigart L, Evan GI, Gutiérrez JL, Nishinakamura R, Castro AF, Pincheira R
Cell death & disease 2015 Jul 16;6(7):e1816
Cell death & disease 2015 Jul 16;6(7):e1816
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cerebellum shows strong nuclear positivity in Purkinje cells, cells in molecular layer and cells in granular layer.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human liver shows no positivity in hepatocytes as expected.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cerebellum shows moderate nuclear positivity, mainly in cells in granular layer.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cerebral cortex shows moderate nuclear positivity in glial cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human tonsil shows no positivity in non-germinal center cells as expected.
- Sample type
- HUMAN