Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- NBP1-70474 - Provider product page
- Provider
- Novus Biologicals
- Proper citation
- Novus Cat#NBP1-70474, RRID:AB_11041282
- Product name
- Rabbit Polyclonal C5orf55 Antibody
- Antibody type
- Polyclonal
- Antigen
- Synthetic peptides corresponding to LOC116349(hypothetical protein BC014011) The peptide sequence was selected from the N terminal of LOC116349. Peptide sequence PAVFMLASSSALQCGRGVPRFPRTEVGAGHSVNEETKAEKVGNQTSVIPA.
- Reactivity
- Human
- Host
- Rabbit
- Vial size
- 0.05 mg
- Concentration
- LYOPH
- Storage
- Store at -20°C. Avoid freeze-thaw cycles.
No comments: Submit comment
Supportive validation
- Submitted by
- Novus Biologicals (provider)
- Main image
- Experimental details
- Western Blot: C5orf55 Antibody [NBP1-70474] - Titration: 0.2-1 ug/ml, Positive Control: Human Liver.