Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00011336-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00011336-M01, RRID:AB_606204
- Product name
- EXOC3 monoclonal antibody (M01), clone 4A7
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant EXOC3.
- Antigen sequence
SGFGEDVDGYCDTIVAVAEVIKLTDPSLLYLEVST
LVSKYPDIRDDHIGALLAVRGDASRDMKQTIMETL
EQGPAQASPSYVPLFKDIVVPSLNVAKLLK- Isotype
- IgG
- Antibody clone number
- 4A7
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references West Nile virus and dengue virus capsid protein negates the antiviral activity of human Sec3 protein through the proteasome pathway.
Exocyst subunits are involved in isoproterenol-induced amylase release from rat parotid acinar cells.
Bhuvanakantham R, Ng ML
Cellular microbiology 2013 Oct;15(10):1688-706
Cellular microbiology 2013 Oct;15(10):1688-706
Exocyst subunits are involved in isoproterenol-induced amylase release from rat parotid acinar cells.
Imai A, Yoshie S, Haga-Tsujimura M, Nashida T, Shimomura H
European journal of oral sciences 2012 Apr;120(2):123-31
European journal of oral sciences 2012 Apr;120(2):123-31
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of EXOC3 expression in transfected 293T cell line by EXOC3 monoclonal antibody (M01), clone 4A7.Lane 1: EXOC3 transfected lysate(86.845 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged EXOC3 is approximately 3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol