H00008100-A01
antibody from Abnova Corporation
Targeting: IFT88
D13S1056E, hTg737, MGC26259, Tg737, TTC10
Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00008100-A01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00008100-A01, RRID:AB_606440
- Product name
- IFT88 polyclonal antibody (A01)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a partial recombinant IFT88.
- Antigen sequence
RLEKMKEIREQRIKSGRDGSGGSRGKREGSASGDS
GQNYSASSKGERLSARLRALPGTNEPYESSSNKEI
DASYVDPLGPQIERPKTAAKKRIDEDDFADEELGD
DLLPE- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Disruption of intraflagellar protein transport in photoreceptor cilia causes Leber congenital amaurosis in humans and mice.
Boldt K, Mans DA, Won J, van Reeuwijk J, Vogt A, Kinkl N, Letteboer SJ, Hicks WL, Hurd RE, Naggert JK, Texier Y, den Hollander AI, Koenekoop RK, Bennett J, Cremers FP, Gloeckner CJ, Nishina PM, Roepman R, Ueffing M
The Journal of clinical investigation 2011 Jun;121(6):2169-80
The Journal of clinical investigation 2011 Jun;121(6):2169-80
No comments: Submit comment
No validations: Submit validation data