AV47434

CSGALNACT1 antibody from MilliporeSigma / Merck KGaA
ChGn, CSGalNAcT-1, FLJ11264
No application information provided.

Antibody data

Product number
AV47434
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#AV47434, RRID:AB_1846648
Product name
Anti-CSGALNACT1 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - AV47434
Antibody type
Polyclonal
Antigen
synthetic peptide corresponding to a region of human CSGALNACT1 with an internal ID of P28313
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
AAVPFDSFTLQKVYQLETGLTRHPEEKPVRKDKRD
ELVEAIESALETLNS
Storage
-20C
Provider Type Product Number
- No reagents -