HPA038483

ADCY2 antibody from Atlas Antibodies
AC2, HBAC2, KIAA1060

Antibody data

Product number
HPA038483
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA038483, RRID:AB_10675799
Product name
Anti-ADCY2
Provider product page
Atlas Antibodies - HPA038483
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
HISSVTLEHLNGAYKVEEGDGDIRDPYLKQHLVKT
YFVINPKGERRSPQHLFRPRHTLDGAK
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.