H00000108-M01

ADCY2 antibody from Abnova Corporation
AC2, HBAC2, KIAA1060

Antibody data

Product number
H00000108-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00000108-M01, RRID:AB_605906
Product name
ADCY2 monoclonal antibody (M01), clone 1D4
Provider product page
Abnova Corporation - H00000108-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant ADCY2.
Antigen sequence
GKLDAINKHSFNDFKLRVGINHGPVIAGVIGAQKP
QYDIWGNTVNVASRMDSTGVLDKIQVTEETSLVLQ
TLGYTCTCRGIINVKGKGDLKTYFVNTEMSRSLSQ
SNVAS
Isotype
IgG
Antibody clone number
1D4
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -