WH0000108M1

ADCY2 antibody from MilliporeSigma / Merck KGaA
AC2, HBAC2, KIAA1060
ELISA
Recommended by provider

Antibody data

Product number
WH0000108M1
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#WH0000108M1, RRID:AB_1839400
Product name
Monoclonal Anti-ADCY2 antibody produced in mouse
Provider product page
MilliporeSigma / Merck KGaA - WH0000108M1
Antibody type
Monoclonal
Antigen
ADCY2 (NP_065433, a.a. 977-1087) partial recombinant protein with GST tag. MW of the GST tag alone is 26 kDa.
Description
purified immunoglobulin
Reactivity
Human
Antigen sequence
GKLDAINKHSFNDFKLRVGINHGPVIAGVIGAQKP
QYDIWGNTVNVASRMDSTGVLDKIQVTEETSLVLQ
TLGYTCTCRGIINVKGKGDLKTYFVNTEMSRSLSQ
SNVAS* (without GST)
Isotype
IgG
Storage
-20C
Provider Type Product Number
- No reagents -