Antibody data
- Product number
- HPA041070
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA041070, RRID:AB_2677285
- Product name
- Anti-NPM2
- Provider product page
- Atlas Antibodies - HPA041070
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
GSGPVFLSGQERYEASDLTWEEEEEEEGEEEEEEE
EDDEDEDADISLEEQSPVKQVKRLVPQKQASVAKK
KKLEKEEEEIRASVRDKSPVKKAKATARAKKPGFK
K
- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus & nucleoli.
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human pancreas shows strong nuclear positivity in islet cells.
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human parathyroid gland shows high expression.
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human liver shows low expression as expected.
- Sample type
- HUMAN
Enhanced validation
- Submitted by
-
Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Immunohistochemistry analysis in human parathyroid gland and liver tissues using Anti-NPM2 antibody. Corresponding NPM2 RNA-seq data are presented for the same tissues.
- Sample type
- HUMAN
- Orthogonal method
- Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
- Show more
Explore
Validate
Learn
Supportive data in Antibodypedia
Enhanced validation
