Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- Immunocytochemistry [1]
- Immunoprecipitation [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00055692-M05 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00055692-M05, RRID:AB_565917
- Product name
- LUC7L monoclonal antibody (M05), clone 2D10
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant LUC7L.
- Antigen sequence
MSAQAQMRALLDQLMGTARDGDETRQRVKFTDDRV
CKSHLLDCCPHDILAGTRMDLGECTKIHDLALRAD
YEIASKERDLFFELDAMDHLESFIAECDRRTELAK
KRLAE- Isotype
- IgG
- Antibody clone number
- 2D10
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- LUC7L monoclonal antibody (M05), clone 2D10 Western Blot analysis of LUC7L expression in IMR-32 ( Cat # L008V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of LUC7L expression in transfected 293T cell line by LUC7L monoclonal antibody (M05), clone 2D10.Lane 1: LUC7L transfected lysate (Predicted MW: 38.4 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of monoclonal antibody to LUC7L on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoprecipitation of LUC7L transfected lysate using anti-LUC7L monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with LUC7L monoclonal antibody.
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol