HPA068992

POLR2E antibody from Atlas Antibodies
hRPB25, hsRPB5, RPABC1, RPB5, XAP4
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA068992
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA068992, RRID:AB_2686065
Product name
Anti-POLR2E
Provider product page
Atlas Antibodies - HPA068992
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
RTDLTVLVAHNDDPTDQMFVFFPEEPKVGIKTIKV
YCQRMQEENITRALIVVQQGMTPSAKQSLVDMAPK
YILEQFLQQ
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -