Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- Immunocytochemistry [1]
- Immunoprecipitation [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00051147-D01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00051147-D01, RRID:AB_10718785
- Product name
- ING4 MaxPab rabbit polyclonal antibody (D01)
- Antibody type
- Polyclonal
- Description
- Rabbit polyclonal antibody raised against a full-length human ING4 protein.
- Antigen sequence
MAAGMYLEHYLDSIENLPFELQRNFQLMRDLDQRT
EDLKAEIDKLATEYMSSARSLSSEEKLALLKQIQE
AYGKCKEFGDDKVQLAMQTYEMVDKHIRRLDTDLA
RFEADLKEKQIESSDYDSSSSKGKKKGRTQKEKKA
ARARSKGKNSDEEAPKTAQKKLKLVRTSPEYGMPS
VTFGSVHPSDVLDMPVDPNEPTYCLCHQVSYGEMI
GCDNPDCSIEWFHFACVGLTTKPRGKWFCPRCSQE
RKKK- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- ING4 MaxPab rabbit polyclonal antibody. Western Blot analysis of ING4 expression in mouse kidney.
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of ING4 expression in transfected 293T cell line (H00051147-T02) by ING4 MaxPab polyclonal antibody.Lane 1: ING4 transfected lysate(28.50 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of purified MaxPab antibody to ING4 on HeLa cell. [antibody concentration 20 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoprecipitation of ING4 transfected lysate using anti-ING4 MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with ING4 purified MaxPab mouse polyclonal antibody (B01P) (H00051147-B01P).
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol