HPA043039

RGS11 antibody from Atlas Antibodies
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA043039
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA043039, RRID:AB_2678282
Product name
Anti-RGS11
Provider product page
Atlas Antibodies - HPA043039
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
GDRLVIACQEQTYWLVNRPPPGAPDVLEQGPGRGS
CAASRVLMTKSADFHKREIEYFRKALGRTRVKSSV
CLEAYLSFCGQRGPHDPL
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -