HPA041143

antibody from Atlas Antibodies

Targeting: EPS8L2 FLJ21935, FLJ22171, MGC3088

Antibody data

Submit

Validation data

Product number: HPA041143 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA041143, RRID:AB_10794985
Product name: Anti-EPS8L2
Antibody type: Polyclonal
Reactivity: Human, Rat
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: SVSCPLLSRDAVDFLRGHLVPKEMSLWESLGESWM RPRSEWPREPQVPLYVPKFHSGWEPPVDVLQEAPW EVEGLASAPIEEVSPVSR
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

EPS8L2 protein structure - HPA041143 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human small intestine and skeletal muscle tissues using HPA041143 antibody. Corresponding EPS8L2 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human colon shows strong cytoplasmic positivity in glandular cells.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human small intestine shows strong cytoplasmic positivity in glandular cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human duodenum shows strong cytoplasmic positivity in glandular cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human skin shows strong cytoplasmic positivity in epidermal cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human skeletal muscle shows no positivity in myocytes.
Sample type: HUMAN