Antibody data

Product number
H00010449-M05
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00010449-M05, RRID:AB_1112378
Product name
ACAA2 monoclonal antibody (M05), clone 2F7
Provider product page
Abnova Corporation - H00010449-M05
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant ACAA2.
Antigen sequence
SLTDQHVQLPMAMTAENLTVKHKISREECDKYALQ
SQQRWKAANDAGYFNDEMAPIEVKTKKGKQTMQVD
EHARPQTTLEQLQKLPPVFKKDGTVTAGNASGVAD
GAGAV
Isotype
IgG
Antibody clone number
2F7
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -