HPA010811

antibody from Atlas Antibodies

Targeting: MLF2 NTN4

Antibody data

Submit

Validation data

Product number: HPA010811 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA010811, RRID:AB_1079389
Product name: Anti-MLF2
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: MFRFMRDVEPEDPMFLMDPFAIHRQHMSRMLSGGF GYSPFLSITDGNMPGTRPASRRMQQA
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

MLF2 protein structure - HPA010811 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human cerebral cortex and pancreas tissues using Anti-MLF2 antibody. Corresponding MLF2 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex, kidney, liver and testis using Anti-MLF2 antibody HPA010811 (A) shows similar protein distribution across tissues to independent antibody HPA010859 (B).
Antibody #2 product nr: HPA010859
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex shows strong nuclear and cytoplasmic positivity in neuronal cells.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human pancreas shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney using Anti-MLF2 antibody HPA010811.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis using Anti-MLF2 antibody HPA010811.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver using Anti-MLF2 antibody HPA010811.
Sample type: HUMAN