Antibody data
- Antibody Data
- Antigen structure
- References [10]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- 29470002 - Provider product page
- Provider
- Novus Biologicals
- Proper citation
- Novus Cat#29470002, RRID:AB_2178279
- Product name
- Rabbit Polyclonal REC8 Antibody
- Antibody type
- Polyclonal
- Antigen
- This antibody was made against a protein fragment from the C Terminus Region
- Host
- Rabbit
- Antigen sequence
MRTEEELENVRRRQKSSLGVQFMRTDDLEEDTRRN
RLFEDEERTRDAREDELFFYSSGSLLPNNRLNIHK
ELLNEAEARYPEWVNFNEFTADHDRKKAAT- Vial size
- 0.05 mg
- Storage
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Submitted references Dynein Light Chain DLC-1 Facilitates the Function of the Germline Cell Fate Regulator GLD-1 in Caenorhabditis elegans.
Condensin I protects meiotic cohesin from WAPL-1 mediated removal.
atz-1 Influences meiosis to maintain germline chromosomal stability in Caenorhabditis elegans.
Proteomic Analysis, Immune Dysregulation, and Pathway Interconnections with Obesity.
Cohesin-interacting protein WAPL-1 regulates meiotic chromosome structure and cohesion by antagonizing specific cohesin complexes.
Divergent kleisin subunits of cohesin specify mechanisms to tether and release meiotic chromosomes.
PAB-1, a Caenorhabditis elegans poly(A)-binding protein, regulates mRNA metabolism in germline by interacting with CGH-1 and CAR-1.
High-throughput screening for native autoantigen-autoantibody complexes using antibody microarrays.
MRG-1 is required for genomic integrity in Caenorhabditis elegans germ cells.
Pairing centers recruit a Polo-like kinase to orchestrate meiotic chromosome dynamics in C. elegans.
Ellenbecker M, Osterli E, Wang X, Day NJ, Baumgarten E, Hickey B, Voronina E
Genetics 2019 Feb;211(2):665-681
Genetics 2019 Feb;211(2):665-681
Condensin I protects meiotic cohesin from WAPL-1 mediated removal.
Hernandez MR, Davis MB, Jiang J, Brouhard EA, Severson AF, Csankovszki G
PLoS genetics 2018 May;14(5):e1007382
PLoS genetics 2018 May;14(5):e1007382
atz-1 Influences meiosis to maintain germline chromosomal stability in Caenorhabditis elegans.
Dawson JA, Methven-Kelley C, Davis GM
Cell biology international 2017 Oct;41(10):1160-1168
Cell biology international 2017 Oct;41(10):1160-1168
Proteomic Analysis, Immune Dysregulation, and Pathway Interconnections with Obesity.
Garrison CB, Lastwika KJ, Zhang Y, Li CI, Lampe PD
Journal of proteome research 2017 Jan 6;16(1):274-287
Journal of proteome research 2017 Jan 6;16(1):274-287
Cohesin-interacting protein WAPL-1 regulates meiotic chromosome structure and cohesion by antagonizing specific cohesin complexes.
Crawley O, Barroso C, Testori S, Ferrandiz N, Silva N, Castellano-Pozo M, Jaso-Tamame AL, Martinez-Perez E
eLife 2016 Feb 4;5:e10851
eLife 2016 Feb 4;5:e10851
Divergent kleisin subunits of cohesin specify mechanisms to tether and release meiotic chromosomes.
Severson AF, Meyer BJ
eLife 2014 Aug 29;3:e03467
eLife 2014 Aug 29;3:e03467
PAB-1, a Caenorhabditis elegans poly(A)-binding protein, regulates mRNA metabolism in germline by interacting with CGH-1 and CAR-1.
Ko S, Kawasaki I, Shim YH
PloS one 2013;8(12):e84798
PloS one 2013;8(12):e84798
High-throughput screening for native autoantigen-autoantibody complexes using antibody microarrays.
Rho JH, Lampe PD
Journal of proteome research 2013 May 3;12(5):2311-20
Journal of proteome research 2013 May 3;12(5):2311-20
MRG-1 is required for genomic integrity in Caenorhabditis elegans germ cells.
Xu J, Sun X, Jing Y, Wang M, Liu K, Jian Y, Yang M, Cheng Z, Yang C
Cell research 2012 May;22(5):886-902
Cell research 2012 May;22(5):886-902
Pairing centers recruit a Polo-like kinase to orchestrate meiotic chromosome dynamics in C. elegans.
Harper NC, Rillo R, Jover-Gil S, Assaf ZJ, Bhalla N, Dernburg AF
Developmental cell 2011 Nov 15;21(5):934-47
Developmental cell 2011 Nov 15;21(5):934-47
No comments: Submit comment
No validations: Submit validation data