Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA031729 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA031729, RRID:AB_10669915
- Product name
- Anti-REC8
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
PSVPLMVSLEISLEAAEEEKSRISLIPPEERWAWP
EVEAPEAPALPVVPELPEVPMEMPLVLPPELELLS
LEAVHRAVALELQANREPDFSSLVSPLSP- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Potential Role of Meiosis Proteins in Melanoma Chromosomal Instability
Lindsey S, Byrnes D, Eller M, Rosa A, Dabas N, Escandon J, Grichnik J
Journal of Skin Cancer 2013 ;2013
Journal of Skin Cancer 2013 ;2013
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG spLane 4: Human plasma (IgG/HSA depleted)Lane 5: Human liver tissueLane 6: Human tonsil tissue
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human testis shows strong nuclear positivity in secondary spermatocytes.
- Sample type
- HUMAN