Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00007167-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00007167-M01, RRID:AB_425722
- Product name
- TPI1 monoclonal antibody (M01), clone 1D10-2E2
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant TPI1.
- Antigen sequence
MAPSRKFFVGGNWKMNGRKQSLGELIGTLNAAKVP
ADTEVVCAPPTAYIDFARQKLDPKIAVAAQNCYKV
TNGAFTGEISPGMIKDCGATWVVLGHSERRHVFGE
SDELIGQKVAHALAEGLGVIACIGEKLDEREAGIT
EKVVFEQTKVIADNVKDWSKVVLAYEPVWAIGTGK
TATPQQAQEVHEKLRGWLKSNVSDAVAQSTRIIYG
GSVTGATCKELASQPDVDGFLVGGASLKPEFVDTI
NAKQ- Isotype
- IgG
- Antibody clone number
- 1D10-2E2
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Impact of cisplatin administration on protein expression levels in renal cell carcinoma: a proteomic analysis.
Proteomic analysis of butyrate effects and loss of butyrate sensitivity in HT29 colorectal cancer cells.
Proteome of human T lymphocytes with treatment of cyclosporine and polysaccharopeptide: analysis of significant proteins that manipulate T cells proliferation and immunosuppression.
Vasko R, Mueller GA, von Jaschke AK, Asif AR, Dihazi H
European journal of pharmacology 2011 Nov 16;670(1):50-7
European journal of pharmacology 2011 Nov 16;670(1):50-7
Proteomic analysis of butyrate effects and loss of butyrate sensitivity in HT29 colorectal cancer cells.
Fung KY, Lewanowitsch T, Henderson ST, Priebe I, Hoffmann P, McColl SR, Lockett T, Head R, Cosgrove LJ
Journal of proteome research 2009 Mar;8(3):1220-7
Journal of proteome research 2009 Mar;8(3):1220-7
Proteome of human T lymphocytes with treatment of cyclosporine and polysaccharopeptide: analysis of significant proteins that manipulate T cells proliferation and immunosuppression.
Lee CL, Jiang PP, Sit WH, Wan JM
International immunopharmacology 2007 Oct;7(10):1311-24
International immunopharmacology 2007 Oct;7(10):1311-24
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- TPI1 monoclonal antibody (M01), clone 1D10-2E2 Western Blot analysis of TPI1 expression in HepG2 ( Cat # L019V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged TPI1 is approximately 0.3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
