Antibody data
- Antibody Data
- Antigen structure
- References [6]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [1]
- Immunohistochemistry [5]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA001209 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA001209, RRID:AB_1080465
- Product name
- Anti-SUN2
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
LKSEWQSMTQESFQESSVKELRRLEDQLAGLQQEL
AALALKQSSVAEEVGLLPQQIQAVRDDVESQFPAW
ISQFLARGGGGRVGLLQREEMQAQLRELESKILTH
VAEMQGKSAREAAASLSLTLQKEGVIGVTEEQVHH
IVKQALQRYSE- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Nuclear envelope-associated endosomes deliver surface proteins to the nucleus
SUN2 exerts tumor suppressor functions by suppressing the Warburg effect in lung cancer
BRD4 short isoform interacts with RRP1B, SIPA1 and components of the LINC complex at the inner face of the nuclear membrane.
A mammalian KASH domain protein coupling meiotic chromosomes to the cytoskeleton
Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells
Samp1 is functionally associated with the LINC complex and A-type lamina networks
Chaumet A, Wright G, Seet S, Tham K, Gounko N, Bard F
Nature Communications 2015 September;6
Nature Communications 2015 September;6
SUN2 exerts tumor suppressor functions by suppressing the Warburg effect in lung cancer
Lv X, Liu L, Cheng C, Yu B, Xiong L, Hu K, Tang J, Zeng L, Sang Y
Scientific Reports 2015 December;5
Scientific Reports 2015 December;5
BRD4 short isoform interacts with RRP1B, SIPA1 and components of the LINC complex at the inner face of the nuclear membrane.
Alsarraj J, Faraji F, Geiger TR, Mattaini KR, Williams M, Wu J, Ha NH, Merlino T, Walker RC, Bosley AD, Xiao Z, Andresson T, Esposito D, Smithers N, Lugo D, Prinjha R, Day A, Crawford NP, Ozato K, Gardner K, Hunter KW
PloS one 2013;8(11):e80746
PloS one 2013;8(11):e80746
A mammalian KASH domain protein coupling meiotic chromosomes to the cytoskeleton
Horn H, Kim D, Wright G, Wong E, Stewart C, Burke B, Roux K
The Journal of Cell Biology 2013 September;202(7):1023-1039
The Journal of Cell Biology 2013 September;202(7):1023-1039
Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells
Stadler C, Rexhepaj E, Singan V, Murphy R, Pepperkok R, Uhlén M, Simpson J, Lundberg E
Nature Methods 2013 February;10(4):315-323
Nature Methods 2013 February;10(4):315-323
Samp1 is functionally associated with the LINC complex and A-type lamina networks
Gudise S, Figueroa R, Lindberg R, Larsson V, Hallberg E
Journal of Cell Science 2011 May;124(12):2077-2085
Journal of Cell Science 2011 May;124(12):2077-2085
No comments: Submit comment
Enhanced validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Genetic validation
- Main image
- Experimental details
- Western blot analysis in A-431 cells transfected with control siRNA, target specific siRNA probe #1, using Anti-SUN2 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line A-431 shows positivity in nuclear membrane.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human heart muscle shows strong nuclear membrane positivity in myocytes.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cerebral cortex shows moderate to strong positivity in nuclear membrane in neuronal cells and glial cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human testis shows moderate to strong positivity in nuclear membrane in cells in seminiferous ducts.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human stomach shows moderate to strong positivity in nuclear membrane in glandular cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human kidney shows moderate to strong positivity in nuclear membrane in cells in tubules and cells in glomeruli.
- Sample type
- HUMAN