Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00084444-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00084444-M01, RRID:AB_530026
- Product name
- DOT1L monoclonal antibody (M01), clone 6A6
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant DOT1L.
- Antigen sequence
EKLELRLKSPVGAEPAVYPWPLPVYDKHHDAAHEI
IETIRWVCEEIPDLKLAMENYVLIDYDTKSFESMQ
RLCDKYNRAIDSIHQLWKGTTQPMKLNTRPSTGLL
R- Isotype
- IgG
- Antibody clone number
- 6A6
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- DOT1L monoclonal antibody (M01), clone 6A6. Western Blot analysis of DOT1L expression in LNCaP.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged DOT1L is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of monoclonal antibody to DOT1L on HeLa cell . [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol