HPA012800

antibody from Atlas Antibodies

Targeting: PLD3 HU-K4

Western blot

Antibody data

Submit

Validation data

Product number: HPA012800 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA012800, RRID:AB_1855330
Product name: Anti-PLD3
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: LDFPNASTGNPSTSQAWLGLLAGAHSSLDIASFYW TLTNNDTHTQEPSAQQGEEVLRQLQTLAPKGVNVR IAVSKPSGPQPQADLQALLQSGAQVRMVDMQKLTH GVLHTKFWVVDQTHFYLGSAN
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

PLD3 protein structure - HPA012800 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human cerebral cortex and skeletal muscle tissues using HPA012800 antibody. Corresponding PLD3 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells and glial cells.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex shows moderate to strong granular cytoplasmic positivity in neurons.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human rectum shows strong cytoplasmic positivity in lymphoid cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human pancreas shows moderate granular cytoplasmic positivity in islets of Langerhans.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human skeletal muscle shows no granular cytoplasmic positivity in striated muscle fibers as expected.
Sample type: HUMAN