HPA039730

antibody from Atlas Antibodies

Targeting: NBEA BCL8B, FLJ10197, KIAA1544, LYST2

Antibody data

Submit

Validation data

Product number: HPA039730 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA039730, RRID:AB_10794202
Product name: Anti-NBEA
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: ETTRTGSQPGRNIRQEINSPTSTVVVIPSIPHPSL NHGFLAKLIPEQSFGHSFYKETPAAFPDTIKEKET PTPGEDIQVESSIPHTDSGIGEEQVASILNGAELE TSTGPDAMSEL
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

NBEA protein structure - HPA039730 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human cerebral cortex and liver tissues using Anti-NBEA antibody. Corresponding NBEA RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex, gallbladder, pancreas and testis using Anti-NBEA antibody HPA039730 (A) shows similar protein distribution across tissues to independent antibody HPA040385 (B).
Antibody #2 product nr: HPA040385
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human hippocampus shows strong cytoplasmic positivity in neuronal cells.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human pancreas using Anti-NBEA antibody HPA039730.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis using Anti-NBEA antibody HPA039730.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human gallbladder using Anti-NBEA antibody HPA039730.
Sample type: HUMAN