WH0030851M1

TAX1BP3 antibody from MilliporeSigma / Merck KGaA
TIP-1
ELISA
Recommended by provider

Antibody data

Product number
WH0030851M1
Provider
MilliporeSigma / Merck KGaA
Product name
Monoclonal Anti-TAX1BP3 antibody produced in mouse
Provider product page
MilliporeSigma / Merck KGaA - WH0030851M1
Antibody type
Monoclonal
Antigen
TAX1BP3 (AAH23980, a.a. 1-125) full length recombinant protein with GST tag. MW of the GST tag alone is 26 kDa.
Description
purified immunoglobulin
Reactivity
Human
Antigen sequence
MSYIPGQPVTAVVQRVEIHKLRQGENLILGFSIGG
GIDQDPSQNPFSEDKTDKGIYVTRVSEGGPAEIAG
LQIGDKIMQVNGWDMTMVTHDQARKRLTKRSEEVV
RLLVTRQSLQKAVQQSMLS* (without GST)
Isotype
IgG
Storage
-20C