Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN405578 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-GTP Cyclohydrolase I Feedback Regulator (GCHFR) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-GCHFR antibody: synthetic peptide directed towards the N terminal of human GCHFR
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine
- Host
- Rabbit
- Antigen sequence
MPYLLISTQIRMEVGPTMVGDEQSDPELMQHLGAS
KRRAL GNNFYEYYVD- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Novel mutations in the guanosine triphosphate cyclohydrolase 1 gene associated with DYT5 dystonia.
Ohta E, Funayama M, Ichinose H, Toyoshima I, Urano F, Matsuo M, Tomoko N, Yukihiko K, Yoshino S, Yokoyama H, Shimazu H, Maeda K, Hasegawa K, Obata F
Archives of neurology 2006 Nov;63(11):1605-10
Archives of neurology 2006 Nov;63(11):1605-10
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting