Antibody data
- Antibody Data
- Antigen structure
- References [4]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00003670-M05 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00003670-M05, RRID:AB_530103
- Product name
- ISL1 monoclonal antibody (M05), clone 2E7
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant ISL1.
- Antigen sequence
YCKRDYIRLYGIKCAKCSIGFSKNDFVMRARSKVY
HIECFRCVACSRQLIPGDEFALREDGLFCRADHDV
VERASLGAGDPLSPLHPARPLQMAAEP- Isotype
- IgG
- Antibody clone number
- 2E7
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references A positive feedback regulation of ISL-1 in DLBCL but not in pancreatic β-cells.
ISL-1 is overexpressed in non-Hodgkin lymphoma and promotes lymphoma cell proliferation by forming a p-STAT3/p-c-Jun/ISL-1 complex.
Interaction of Wnt/β-catenin and notch signaling in the early stage of cardiac differentiation of P19CL6 cells.
ISL1 promotes pancreatic islet cell proliferation.
Zhang Q, Yang Z, Wang W, Guo T, Jia Z, Ma K, Zhou C
Biochemical and biophysical research communications 2014 Jul 4;449(3):295-300
Biochemical and biophysical research communications 2014 Jul 4;449(3):295-300
ISL-1 is overexpressed in non-Hodgkin lymphoma and promotes lymphoma cell proliferation by forming a p-STAT3/p-c-Jun/ISL-1 complex.
Zhang Q, Yang Z, Jia Z, Liu C, Guo C, Lu H, Chen P, Ma K, Wang W, Zhou C
Molecular cancer 2014 Jul 29;13:181
Molecular cancer 2014 Jul 29;13:181
Interaction of Wnt/β-catenin and notch signaling in the early stage of cardiac differentiation of P19CL6 cells.
Li B, Jia Z, Wang T, Wang W, Zhang C, Chen P, Ma K, Zhou C
Journal of cellular biochemistry 2012 Feb;113(2):629-39
Journal of cellular biochemistry 2012 Feb;113(2):629-39
ISL1 promotes pancreatic islet cell proliferation.
Guo T, Wang W, Zhang H, Liu Y, Chen P, Ma K, Zhou C
PloS one 2011;6(8):e22387
PloS one 2011;6(8):e22387
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- ISL1 monoclonal antibody (M05), clone 2E7 Western Blot analysis of ISL1 expression in PC-12 ( Cat # L012V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of monoclonal antibody to ISL1 on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol