Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00001528-M06 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00001528-M06, RRID:AB_1111771
- Product name
- CYB5A monoclonal antibody (M06), clone 1A8
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full-length recombinant CYB5A.
- Antigen sequence
MAEQSDEAVKYYTLEEIQKHNHSKSTWLILHHKVY
DLTKFLEEHPGGEEVLREQAGGDATENFEDVGHST
DAREMSKTFIIGELHPDDRPKLNKPPETLITTIDS
SSSWWTNWVIPAISAVAVALMYRLYMAED- Isotype
- IgG
- Antibody clone number
- 1A8
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Pomegranate extracts impact the androgen biosynthesis pathways in prostate cancer models in vitro and in vivo.
Ming DS, Pham S, Deb S, Chin MY, Kharmate G, Adomat H, Beheshti EH, Locke J, Guns ET
The Journal of steroid biochemistry and molecular biology 2014 Sep;143:19-28
The Journal of steroid biochemistry and molecular biology 2014 Sep;143:19-28
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of CYB5A expression in transfected 293T cell line by CYB5A monoclonal antibody (M06), clone 1A8.Lane 1: CYB5A transfected lysate(15.3 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged CYB5A is 0.1 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoperoxidase of monoclonal antibody to CYB5A on formalin-fixed paraffin-embedded human liver. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol
