Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunoprecipitation [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00053918-M03 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00053918-M03, RRID:AB_1678903
- Product name
- PELO monoclonal antibody (M03), clone 2C2
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant PELO.
- Antigen sequence
RAFYGLKQVEKANEAMAIDTLLISDELFRHQDVAT
RSRYVRLVDSVKENAGTVRIFSSLHVSGEQLSQLT
GVAAILRFPVPELSDQEGDSSSEED- Isotype
- IgG
- Antibody clone number
- 2C2
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of PELO expression in transfected 293T cell line by PELO monoclonal antibody (M03), clone 2C2.Lane 1: PELO transfected lysate (Predicted MW: 43.4 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged PELO is 0.03 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoprecipitation of PELO transfected lysate using anti-PELO monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with PELO monoclonal antibody.
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol