WH0064109M3

CRLF2 antibody from MilliporeSigma / Merck KGaA
CRL2, TSLPR
ELISA
Recommended by provider

Antibody data

Product number
WH0064109M3
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#WH0064109M3, RRID:AB_1844067
Product name
Monoclonal Anti-CRLF2 antibody produced in mouse
Provider product page
MilliporeSigma / Merck KGaA - WH0064109M3
Antibody type
Monoclonal
Antigen
CRLF2 (NP_071431, a.a. 23-133) partial recombinant protein with GST tag. MW of the GST tag alone is 26 kDa.
Description
purified immunoglobulin
Reactivity
Human, Mouse, Rat
Antigen sequence
QGGAAEGVQIQIIYFNLETVQVTWNASKYSRTNLT
FHYRFNGDEAYDQCTNYLLQEGHTSGCLLDAEQRD
DILYFSIRNGTHPVFTASRWMVYYLKPSSPKHVRF
SWHQD* (without GST)
Isotype
IgG
Storage
-20C
Provider Type Product Number
- No reagents -