Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- 102-PA44S - Provider product page
- Provider
- ReliaTech GmbH
- Product name
- Endocan/ESM-1
- Antibody type
- Polyclonal
- Antigen
- Recombinant human ESM-1
- Description
- antibody Protein-A purified from serum
- Reactivity
- Human
- Host
- Rabbit
- Antigen sequence
WSAKYAVDCPEHCDKTECRSSLRCKRTVLDDCGCC
QVCAAGPGETCYRTVSGMDGVKCGPGLKCHFYSEE
DDFGDEFGICKDCPYGTFGMECKETCNCQSGICDR
VTGRCLDFPFFQYAAAKSPSRTSASHTERDSASGD
GNAVREEIGEGNAARPSVMKWLNPRTRHHHHHH- Antibody clone number
- Rabbit IG
- Vial size
- 100 µl
- Storage
- Store lyophilized at 2-8°C for 6 months or at -20°C long term. After reconstitution store the antibody undiluted at 2-8°C for one month or (in aliquots) at -20°C long term. Avoid repeated freezing and thawing.
- Handling
- Restore in sterile water to a concentration of 0.1-1.0 mg/ml. The antibody solution should be gently mixed before use.
No comments: Submit comment
Supportive validation
- Submitted by
- ReliaTech GmbH (provider)
- Main image
- Experimental details
- Western Analysis of anti-human Endocan/ESM-1. Samples were loaded in 15% SDS-polyacrylamide gel under reducing conditions. Lane 1: MWM (kDa); lane 2: rh ESM-1; lane 3: rm ESM-1
- Sample type
- Purified recombinant proteins
Supportive validation
- Submitted by
- ReliaTech GmbH (provider)
- Main image
- Experimental details
- Immunofluorescence staining of cryo-sections of unfixed human foreskin with anti-human Endocan/EMS1 (dilution 1:100) [Cat# 102-PA44] and counter staining of nuclei with Dapi. Note the specific green Endocan/ESM-1 signal in epidermis, connective tissue cells and vessels. The experiment was performed by the research group of Prof. Dr. J. Wilting and Dr. K. Buttler, University Medicine Göttingen, Germany.
- Sample type
- Human Foreskin